PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 30147.m014478
Common NameLOC8269206, RCOM_1505600
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family SBP
Protein Properties Length: 382aa    MW: 42091.8 Da    PI: 8.6192
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
30147.m014478genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP133.38.1e-4295171278
                    -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
            SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                    C v+gC+adls++++yhrrhkvCe hsk+p+v+++g+++rfCqqCsrfh+l+efDe+krsCr+rL++hn+rrrk+q+
  30147.m014478  95 CLVDGCSADLSNCRDYHRRHKVCELHSKTPQVTIAGQKKRFCQQCSRFHSLEEFDEGKRSCRKRLDGHNRRRRKPQP 171
                    **************************************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.108.8E-3488156IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.06992169IPR004333Transcription factor, SBP-box
SuperFamilySSF1036123.14E-3993174IPR004333Transcription factor, SBP-box
PfamPF031101.0E-3095168IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048653Biological Processanther development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 382 aa     Download sequence    Send to blast
MDWNLTATSW NLTEFKQEAI PNLDSFDSRS ASFADNRSSG DFSIDLKLGR VSHSNDQAIN  60
QWKQPGADSK MECSSPSVST KRARAANNGT QVAYCLVDGC SADLSNCRDY HRRHKVCELH  120
SKTPQVTIAG QKKRFCQQCS RFHSLEEFDE GKRSCRKRLD GHNRRRRKPQ PDLLSRPASF  180
LSNYKGNHLL PFSSTHVYPS TTVVSSAWSG VVNTEADAAG RYSVQQRMNM IGKHSPFFGS  240
SLSSSSSSSY KGGKQLPFLQ VDNNHSPLNH QTASPPPPLS HAASICQPLL RSITMDESSV  300
ISSYSMFCDK LAPTTTQVRD SDCALSLLSS AKAQISGNHM LQPNSVPLAH SAEPMDSVLV  360
SNGRDAWSST DNAPQTLPFN WE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-28951681184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1151168KRSCRKRLDGHNRRRRKP
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00555DAPTransfer from AT5G50570Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002511157.10.0PREDICTED: squamosa promoter-binding-like protein 13A isoform X1
RefseqXP_015578947.10.0PREDICTED: squamosa promoter-binding-like protein 13A isoform X1
TrEMBLB9RAD20.0B9RAD2_RICCO; Squamosa promoter-binding protein, putative
STRINGPOPTR_0015s11100.11e-158(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF25913378
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G50670.14e-76SBP family protein